PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c9_10290V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 642aa    MW: 70362.5 Da    PI: 6.5876
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c9_10290V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.6e-181461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEde+lv+++ ++G g+W+++++  g+ R++k+c++rw +yl
  Pp3c9_10290V3.2.p 14 KGLWSPEEDEKLVRYISKHGHGCWSAVPKQAGLQRCGKSCRLRWINYL 61
                       678*******************************************97 PP

2Myb_DNA-binding46.11.2e-1467110146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg +++ E+ l++d+++ lG++ W+ Ia  ++ gRt++++k++w++
  Pp3c9_10290V3.2.p  67 RGVFSPAEENLIIDLHAVLGNR-WSQIATQLP-GRTDNEIKNFWNS 110
                        899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-26664IPR009057Homeodomain-like
PROSITE profilePS5129425.763965IPR017930Myb domain
SuperFamilySSF466892.7E-2911108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
CDDcd001671.96E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2465116IPR009057Homeodomain-like
SMARTSM007178.1E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129420.3266116IPR017930Myb domain
PfamPF002494.0E-1367110IPR001005SANT/Myb domain
CDDcd001676.15E-1070109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MGRHSCSHKQ KLKKGLWSPE EDEKLVRYIS KHGHGCWSAV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGVF SPAEENLIID LHAVLGNRWS QIATQLPGRT DNEIKNFWNS CIKKKLRNIG  120
IDPNTHKLAT GDSHKNLGGS SRMDPSLEGP FNTSSLLTGA PSSQCPSQAA GLVRFPIHEF  180
KLQSPRMFSS SNMESDGLYN PTRNPHSSPN GSLDDHRNYL EFLKSNSSLG SCKNTFPLST  240
DNLLERLRLS GEYNGTQLSP TVPLLTTQTG HVSSPFDSGS INSSSLPLPG QDNDLQQDGV  300
KPEPATVVPA AYNPVFWLLQ GSERSSQGLV QGSMSNGLQQ MLQHSQHYFK SFGDQKGSST  360
QDKIPKVEMR LDTFTSSSRM AQVVDKGDLS SMTASFHLPQ SGSISTQNIC PRAPGICTSI  420
DTPYPGSIRT INFKGTHVEG EKSFSSDEIA AAGRHELQYH WDRGSSCASS STSNNTEISI  480
PGSLFETSTM LWAGGLVEKP DAVEQNQLML ARPCKINQST VVSVDETCSD HSGGFSLDQS  540
DGDTMMKWCS GEIIPMAEPA LNLATAPHGN EQAYSDRQVK VQYAPDEEVA QEEQPFSNSR  600
VSMNWQNIHQ SGQEMYDPSE AQLIAPMSPE LQRMAAVLDQ I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28121165108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S24_48V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.33e-79myb domain protein 55